Conus emaciatus I-superfamily 11.5 mRNA, complete cds. (N01606) Nucleic Acid Card

General Information
Name Conus emaciatus I-superfamily 11.5 mRNA, complete cds.
Organism Conus emaciatus
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttcgattgacgtcagtcggctgtttcctgctgg
tcatcgcttgtctgaacttgtttcaggttgtgcttaccag
acgctgcttccctctaggaacgttctgctcaagatatctc
ccctgctgtagtggaatgtgctgttctgggtggtgcacac
gaaggtgtgccccaaggtttggaaagagggcgacattcca
agaa
tgaattcattctacatcgttgatatgttgcccagat
gtctgctgcttttcgtcgtaaatggcagataactcaagcc
tgacgtttctgcagttctgtctccccgtcttcttctccct
tcgccctctcaccctctcttccttctcctctccacacgat
gctaataaatttgatgctgcagaatcaaaaaaaaaaaaaa
aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaaaaaaaa
Sequence translation MMFRLTSVGCFLLVIACLNLFQVVLTRRCFPLGTFCSRYL
PCCSGMCCSGWCTRRCAPRFGKRATFQE

References
Liu,Z., Xu,N., Hu,J., Zhao,C., Yu,Z. and Dai,Q. (2009) Identification of novel I-superfamily conopeptides from several clades of Conus species found in the South China Sea. Peptides 30:1782-1787

Internal links
Proteins Encoded Em11.5 precursor

External links
Ncbi
GenBank GQ180866

Tools