Conus eburneus I-superfamily 11.3 mRNA, complete cds. (N01607) Nucleic Acid Card

General Information
Name Conus eburneus I-superfamily 11.3 mRNA, complete cds.
Organism Conus eburneus
Organism Diet piscivorous
Organism Clade
Organism Region
Notes

Sequence
atgatgtttcgattgacgtcagtctggtgtttgctggtca
tcgttcttctgaactcggctgtggatggtttcattccctg
taccgggtccgaaggatactgccattcgcatatgtggtgc
tgcaattcgtttgatgtctgttgtgaactccccggaccgg
caacgtgcacaagagaagaggcgtgtgaaactctgcgaat
tgctctaggacgccgggcacaatacaaacgtttcttcaga
cgc
tgaaatatccgcccgcaggattcaatgcccccagacc
gctcaagtcaggtacttctgggcatcattctacagccatc
cttttgttctccagccttctcccttccctctctcccttcc
cccgcccaatcacaccctgtcctccccagcacgctgacaa
agacgacctttcagagcctgggctcaggttcaccttcagt
tgtcgccggtagttcttcaccatgtcgattctctcctctt
tctctcagctgtcagcgacccctatcctctctccacctct
ccatcctccctcattattctttcttttaatctttctttga
tgcctgaactggaagcaaaatggcaataaagttgcagtgg
caacatataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
a
Sequence translation MMFRLTSVWCLLVIVLLNSAVDGFIPCTGSEGYCHSHMWC
CNSFDVCCELPGPATCTREEACETLRIALGRRAQYKRFFR
R

References
Liu,Z., Xu,N., Hu,J., Zhao,C., Yu,Z. and Dai,Q. (2009) Identification of novel I-superfamily conopeptides from several clades of Conus species found in the South China Sea. Peptides 30:1782-1787

Internal links
Proteins Encoded Eu11.3 precursor

External links
Ncbi
GenBank GQ180867

Tools