Conus eburneus I-superfamily 11.7 mRNA, complete cds. (N01608) Nucleic Acid Card

General Information
Name Conus eburneus I-superfamily 11.7 mRNA, complete cds.
Organism Conus eburneus
Organism Diet piscivorous
Organism Clade
Organism Region
Notes

Sequence
atgatgtttcgattgacgtcagtcagctgtttcctgctgg
tcatcgtttgtctgaacttgtttcaggttgtgcttaccag
acgctgcttccctccaggaacgttctgctcaagatatctc
ccctgctgtagtggaaggtgctgttctgggtggtgcacac
gaaggtgtttcccaaggtttggaaagagggcgacattcca
agaa
tgaattcattctacatcgttgatatgttgcccagat
gtctgctgcttttcgtcgtaaatggcagataactcaagcc
tgacgtttctgcagttctgtctccccgtcttcttcttcct
tcgccctctcaccctctcttccttctcctctccacacgat
gctaataaatttgatgctgcagaatccaaaaaaaaaaaaa
Sequence translation MMFRLTSVSCFLLVIVCLNLFQVVLTRRCFPPGTFCSRYL
PCCSGRCCSGWCTRRCFPRFGKRATFQE

References
Liu,Z., Xu,N., Hu,J., Zhao,C., Yu,Z. and Dai,Q. (2009) Identification of novel I-superfamily conopeptides from several clades of Conus species found in the South China Sea. Peptides 30:1782-1787

Internal links
Proteins Encoded Eu11.7 precursor

External links
Ncbi
GenBank GQ180868

Tools