Vt11.3 mRNA, complete cds. (N01613) Nucleic Acid Card

General Information
Name Vt11.3 mRNA, complete cds.
Organism Conus vitulinus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes The associated peptide was originally published under the name "Vi11.3" but the abbreviation for Conus vitulinus is "Vt" and not "Vi", which is used to designate peptides from Conus virgo. A peptide with the name "Vi11.3" was already isolated from Conus virgo, and we therefore recommend the usage of the new name Vt11.3.

Sequence
atgatgtttcgattgacgtcagtcggctgtttcctgctgg
ccattgttcttcttaacgtggctgtgcttaccaatgctag
ctgccgcaatgaaggagcgatgtgcagttttggttttcaa
tgctgtaaaaagaaatgctgtatgtcgcattgcacagatt
tttgtcgcaatcctggtaaaagggcgcacggacacggtct
gttgagattttggggccaacgt
tgacatgttgcccagagg
tctgcagcttttcgtcatgtatggcagataactcagacct
gacgtttctgcatttctttctccccgtcttcttcctttgc
ccctctcaccccctctctctcctcttccccacatcatgct
aataaatttgatgctgcagaatccaaaaaaaaaaaa
Sequence translation MMFRLTSVGCFLLAIVLLNVAVLTNASCRNEGAMCSFGFQ
CCKKKCCMSHCTDFCRNPGKRAHGHGLLRFWGQR

References
Liu,Z., Xu,N., Hu,J., Zhao,C., Yu,Z. and Dai,Q. (2009) Identification of novel I-superfamily conopeptides from several clades of Conus species found in the South China Sea. Peptides 30:1782-1787

Internal links
Proteins Encoded Vt11.3 precursor

External links
Ncbi
GenBank GQ184578

Tools