Conus ebraeus O-superfamily conotoxin (E1) mRNA, E1c allele,partial cds. (N01624) Nucleic Acid Card

General Information
Name Conus ebraeus O-superfamily conotoxin (E1) mRNA, E1c allele,partial cds.
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
c
gtgttgatcatcgccgtgctgttcctgacggcctgtcaa
ctcactacagctgagacttactccagaggtaggcagaagc
atcgtgctcggaggtcaactgacaaaaactccaagtggac
cagggaatgcacacgttccggcggagcctgttatagtcat
aatcaatgctgcgacgatttttgcagtacggcgaccagca
catgtgtt
taaactcgtggggcgcctgatatttccctttc
gtgatctatcctcttttg
Sequence translation VLIIAVLFLTACQLTTAETYSRGRQKHRARRSTDKNSKWT
RECTRSGGACYSHNQCCDDFCSTATSTCV

References
Duda,T.F. Jr., Chang,D., Lewis,B.D. and Lee,T. (2009) Geographic variation in venom allelic composition and diets of the widespread predatory marine gastropod Conus ebraeus. PLoS ONE 4

Internal links
Proteins Encoded Eb6.22 precursor

External links
Ncbi
GenBank FJ804532

Tools