Conus sponsalis isolate H1a four-loop conotoxin mRNA, partial cds. (N01641) Nucleic Acid Card

General Information
Name Conus sponsalis isolate H1a four-loop conotoxin mRNA, partial cds.
Organism Conus sponsalis
Organism Diet vermivorous
Organism Clade XV
Organism Region Indo-Pacific
Notes

Sequence
cgtgttgctcatcgccgtgctgttcctggcggcctgtcaa
ctcattacatctgcgagttacgtcagaagtgagcggaagc
atcctgatatgaggtcgagcatccgaaactccatgttaac
caagaagcgttgcctgactactggcgaaacttgttggctc
gctagttcctgctgcagcttttcgtgcaccaacaacgtct
gcttctaa
agctggtctggcgtctggcaatccccttctgc
gctctgtcctcttttc
Sequence translation RVAHRRAVPGGLSTHYICELRQK-AEAS-YEVEHPKLHVN
QEALPDYWRNLLAR-FLLQLFVHQQRLLL?

References
Duda,T.F. Jr., Bolin,M.B., Meyer,C.P. and Kohn,A.J. (2008) Hidden diversity in a hyperdiverse gastropod genus: discovery of previously unidentified members of a Conus species complex. Mol. Phylogenet. Evol. 49:867-876

Internal links
Proteins Encoded Sp6.1 precursor

External links
Ncbi
GenBank EU423372

Tools