Conus pulicarius T-1-conotoxin pu5e precursor, mRNA, complete cds. (N01644) Nucleic Acid Card

General Information
Name Conus pulicarius T-1-conotoxin pu5e precursor, mRNA, complete cds.
Organism Conus pulicarius
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgtgtcccagtcttcatcatccttctggtgctga
ttgcatctgcacctagcgtggatgcccgaccacagaccaa
agatgatgccctggcgtctttccgtgatagcataaagcga
cacctacaaacacttttggacgcacgcgagtgctgcccac
aatctcctccgtgctgtcattattattattatggaagttg
gaaa
tga
Sequence translation MRCVPVFIILLVLIASAPSVDARPQTKDDALASFRDSIKR
HLQTLLDARECCPQSPPCCHYYYYGSWK

References
Peng,C., Wu,X., Han,Y., Yuan,D., Chi,C. and Wang,C. (2007) Identification of six novel T-1 conotoxins from Conus pulicarius by molecular cloning. Peptides 28:2116-2124

Internal links
Proteins Encoded Pu5.5 precursor

External links
Ncbi
GenBank EF488467

Tools