Lt12.4 precursor, mRNA,complete cds (N01645) Nucleic Acid Card

General Information
Name Lt12.4 precursor, mRNA,complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
gaaaacattgctgagaacacttcatttgagcagcgcaaca
ggatctgagaagacttttgacttccacaagaacgtaaact
agccgtgatcagcagcaag
atgttcggtcatacgtcagtc
agttttcttctgctctccatcatggctcttggcatggtgc
caacggttatttgctggtgtagcgagagagtctcggatga
aacctgtgtaatgatgtgccgttgcctcaatcatgagtgc
tgtcctttacctccaccctcacagaatcggtgtatgccaa
gtgatcattgcgacttcatgtccggtagaactggtcgccg
cagatcaactcagatgctgcgtactattgccaactag
tct
gtgtggcaagagagccgacaccaaatcctggggatttcct
ttccgaagttttgttttcccccttttttccctcagctgtt
gagctgatcaagtaaggacttcctcaccatctaaacatcg
ctggcagcaacacacctgcatagcctatatgtaccgattt
catctttcatttggctacatttattattgatttcagcctt
cttggttttcttcaactgccagcggtttttgacttttttt
tcaatgcaaaaatttttcttgaagtgtatattgaagtaaa
aaaaaatactgcgataataaaattactttgacagcaaaaa
aaaaaa
Sequence translation MFGHTSVSFLLLSIMALGMVPTVICWCSERVSDETCVMMC
RCLNHECCPLPPPSQNRCMPSDHCDFMSGRTGRRRSTQML
RTIAN-

References
Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links
Proteins Encoded Lt12.4 precursor

External links
Ncbi
GenBank GQ479944

Tools