Conus tessulatus clone TsMSGL-2 conotoxin scaffold VI/VII precursor, mRNA, complete cds (N00165) Nucleic Acid Card

General Information
Name Conus tessulatus clone TsMSGL-2 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Organism Conus tessulatus
Organism Diet vermivorous
Organism Clade XVI
Organism Region Indo-Pacific
Notes

Sequence
tttcaactcactacgtggcagttgcagttttcaacgtgtt
gacagttcaggattgaacaaattcagg
atgtcaggattgg
gaatcatggtgctaacccttctacttcttgtgttcatggc
aaccagtcatcaggatgcaggagagaagcaggcgacgcaa
agggacgcagtcaacgtcagacggagaagatcaatcgctg
ggagaacaacaaccgaggagtgcgatgagtactgtgagga
tctaaacaagaactgctgcggcttatcaaatggagaaccc
gtatgtgccacggcatgcctcgga
tagtttgtgtacagtg
tctcagtcattgtcttatcagtacaagtgtaaacgagacc
tgtcagaaagtcgaaggttgtgcgtaatttgataagcatt
gttcactg
Sequence translation MSGLGIMVLTLLLLVFMATSHQDAGEKQATQRDAVNVRRR
RSIAGRTTTEECDEYCEDLNKNCCGLSNGEPVCATACLG

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Ts6.7 precursor

External links
Ncbi
GenBank AF215065

Tools