Gla-MrII mRNA, complete cds. (N01651) Nucleic Acid Card

General Information
Name Gla-MrII mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgttcggtcatacgtcagtcagttttcttctgctctcca
tcgtggctcttggcatggtggcgacggttatttgctcgtg
tgactcggaattctcgagtgaattctgtgaacagccggaa
gaaaggatctgctcgtgctccactcatgtgtgctgtcatt
tgagttcaagcaaaagggatcagtgtatgacatggaatag
gtgcctctctgcgcaaacaggaaatcgcagatcaactcat
atgcaaaaaagattccttcgtatgccacgtgatcttgccg
actag
tctgtgtgacaagagagctgacaccaaatcctggg
gattcccttaccgaagttttgctgtccccccttttttccc
tcacctgttgagctgatcaaatagggactcccccaccatc
tatacatcgctgacagcaacaaacctgcaaaacctacatg
tacctggttcatctttcattcggctccatttattattgat
ttcagtcttcttggttttcttcagctgtcagcggttcttg
tcttttttcagtacaaagatatttcttgaagtgtatactg
aagttaaaaaaaaaaaaaaa
Sequence translation MFGHTSVSFLLLSIVALGMVATVICSCDSEFSSEFCEQPE
ERICSCSTHVCCHLSSSKRDQCMTWNRCLSAQTGNRRSTH
MQKRFLRMPRDLAD-

References
Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links
Proteins Encoded Gla-MrII precursor

External links
Ncbi
GenBank GQ228841

Tools