Eb12.7 mRNA, complete cds (N01652) Nucleic Acid Card

General Information
Name Eb12.7 mRNA, complete cds
Organism Conus eburneus
Organism Diet piscivorous
Organism Clade
Organism Region
Notes

Sequence
atgttcggtcatacgtcagtcagttttcttctgctctcca
tcatggctcttggcatggtggcgacggttatttgcttgtg
tgactcgtacatctcgagtgaactctgtgaacatccggaa
gaaacctgcttttgccccaatcatatgtgctgtccgttga
gtccatacagacaggatcagtgtatgtattgggaagcgtg
ccacatatttcgaaaaccagtgggtagcagatga
actcat
atgcaaaaaaaaaa
Sequence translation MFGHTSVSFLLLSIMALGMVATVICLCDSYISSELCEHPE
ETCFCPNHMCCPLSPYRQDQCMYWEACHIFRKPVGSR-

References

Internal links
Proteins Encoded Eu12.7 precursor

External links
Ncbi
GenBank GQ228840

Tools