Lt12.9 mRNA, complete cds (N01654) Nucleic Acid Card

General Information
Name Lt12.9 mRNA, complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgttcggtcatacgtcagtcagttttcttctgctctcca
tcatggttcttggcgtggtggcaacggttatttgctcgtg
tggagtgagaatatcgagtgaaatctgtgaacagccggaa
gaacggatctgttcgtgctccaatcatatgtgctgtcctt
tgaatccatcacaaagggatcagtgtatggcaaggaatgt
gtgcttcatcatgatcggtatatatggtggccgcagatca
actcggatgcaagaaagattccttcgtatgtcacgaggtc
ttgccgactattctgtgtga
caagagagccgacaccaaat
cctggggattccctttccgaagttttgctttccccccttt
ttttcccctcagctgttgagctgatcacatagggacttcc
tcaccatctaaacatcgctggcagcaacacacctgcagag
cctacatgtaccggtttcatctttcatttggctacactta
ttattgatttcagtcttcttggttttcttcagctgccagc
ggtttttgacttttttcaatacaaagatttttcttgaagt
gtatattgaagtaaaaaaa
Sequence translation MFGHTSVSFLLLSIMVLGVVATVICSCGVRISSEICEQPE
ERICSCSNHMCCPLNPSQRDQCMARNVCFIMIGIYGGRRS
TRMQERFLRMSRGLADYSV-

References
Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links
Proteins Encoded Lt12.9 precursor

External links
Ncbi
GenBank GQ228838

Tools