Ca15a precursor, mRNA, complete cds (N01656) Nucleic Acid Card

General Information
Name Ca15a precursor, mRNA, complete cds
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
ccttcatc
atggagaaacttacaatcctgattcttgttgc
cactgtcctgttggcgatccaggtcctggttcaaagtgac
agagagaaacctctgaaggggagggtcaaacaatacgcag
cgaaacgtctctcggcactcctgagagggccacgcgaatg
cacacctatgcatcgggcttgtgaggaggatgaggaatgt
tgcccaaatcttgagtgtaaatgctctagcaatcctgatt
gccagtctggttataaatgtagaccttga
cgaccccatgc
caccctatatcaatacatcagagccacaacc
Sequence translation MEKLTILILVATVLLAIQVLVQSDREKPLKGRVKQYAAKR
LSALLRGPRECTPMHRACEEDEECCPNLECKCSSNPDCQS
GYKCRP-

References

Internal links
Proteins Encoded Ca15a precursor

External links
Ncbi
GenBank GQ414743

Tools