SrXIA, mRNA, complete cds (N01663) Nucleic Acid Card

General Information
Name SrXIA, mRNA, complete cds
Organism Conus spurius
Organism Diet vermivorous
Organism Clade
Organism Region Western Atlantic and Caribbean
Notes

Sequence
atgatgttttgtgtgacgtcagtccgctgtttcctgctgg
tcatcgtttttctgaacttggttgtgcttaccaatgcgtg
cagaactgaaggaatgtcctgcgaagagaatcagcaatgc
tgttggcgttcttgctgtaggggagaatgcgaagctccgt
gtcgatttggtcctggaaagagggcgcaactccaagaatt
ctttcaacatcg
ttga
Sequence translation MMFCVTSVRCFLLVIVFLNLVVLTNACRTEGMSCEENQQC
CWRSCCRGECEAPCRFGPGKRAQLQEFFQH?

References
Zamora-Bustillos,R., Aguilar,M.B. and Falcón,A. (2009) Identification, by molecular cloning, of a novel type of I(2)-superfamily conotoxin precursor and two novel I(2)-conotoxins from the worm-hunter snail Conus spurius from the Gulf of México Peptides 31:384-393

Internal links
Proteins Encoded SrXIA precursor

External links
Ncbi
GenBank

Tools