11.3 mRNA, complete cds (N01669) Nucleic Acid Card

General Information
Name 11.3 mRNA, complete cds
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgaagctggttttggcgatcgttgttattctgatgcttc
tatccttaagcaccggagcggagatgtctgacaaccatgc
aagcaggagtgccactgcactgagagacaggcttcttagt
ccaaaggcatcgatatgctatgggacgggtgggagatgta
ccaaggataagcattgctgtggatggctctgttgtggcgg
gccgtccgttggatgcgttgtttcagtcgcgccgtgcaag
tga
atttgtgtcgtctgggagggcgcagcagcctgctgcc
aaatcgaatgagcatagtgtcaacatttgttgattaaagc
caaatggcgtagaaaaaaaaaaaaaaaa
Sequence translation MKLVLAIVVILMLLSLSTGAEMSDNHASRSATALRDRLLS
PKASICYGTGGRCTKDKHCCGWLCCGGPSVGCVVSVAPCK
-

References
Yuan, D., Liu, L., Chi, C. and Guo, Z. (0) New conotoxins define a novel I3-superfamily Unpublished

Internal links
Proteins Encoded Ca11.3 precursor

External links
Ncbi
GenBank FJ531696

Tools