11.1 mRNA, complete cds (N01670) Nucleic Acid Card

General Information
Name 11.1 mRNA, complete cds
Organism Conus pulicarius
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgaagctggttttggcgatcgttcttattctgatgcttc
tatccttaagcaccggagcggagatgtctgacaaccatgc
aagcaggagtgccactgcactgacagacaggcttcttggt
ccgaaggcatccatatgccgtgggacgggtgggagatgta
ccaaggataagcattgctgtggatggctctgttgtggcgg
gccgtccgttggatgcgctacttcattcgcgccgtgcaat
tga
atttgtgtcgtatgggagggcgcagttctggcacgct
tgtacatccacatttacagctgcctgctgccaaatcgaat
gagcatagcgtcaacatttgttgattaaagccaaatggcg
tagaaaaaaaaaaaaaaaa
Sequence translation MKLVLAIVLILMLLSLSTGAEMSDNHASRSATALTDRLLG
PKASICRGTGGRCTKDKHCCGWLCCGGPSVGCATSFAPCN
-

References
Yuan, D., Liu, L., Chi, C. and Guo, Z. (0) New conotoxins define a novel I3-superfamily Unpublished

Internal links
Proteins Encoded Pu11.1 precursor

External links
Ncbi
GenBank FJ531697

Tools