E1.3B gene, partial cds (N01675) Nucleic Acid Card

General Information
Name E1.3B gene, partial cds
Organism Conus ermineus (Atlantic fish-hunting cone)
Organism Diet piscivorous
Organism Clade III
Organism Region Eastern Atlantic and Mediterranean,Western Atlantic and Caribbean
Notes

Sequence
atgttcatcgtgtttctgttggttgtcttggcaaccactg
tcggttccttcactttagatcgtgttctggaaggcaggaa
tgctgcagccatcgacaacgccttagaccagagggatcca
aagcgacagaccccggggtgctgttggaatcctgcctgtg
tgaagaacagatgtggaagacg
c
Sequence translation MFIVFLLVVLATTVGSFTLDRVLEGRNAAAIDNALDQRDP
KRQTPGCCWNPACVKNRCGR?

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded EIIA precursor

External links
Ncbi
GenBank FJ937347

Tools