Conus achatinus isolate Ac4.1 superfamily conotoxin gene, completecds. (N01679) Nucleic Acid Card

General Information
Name Conus achatinus isolate Ac4.1 superfamily conotoxin gene, completecds.
Organism Conus achatinus
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactc
tcgtttccatcccttcagatcgtgcatctgatttcaggaa
tgccgcagtccacgagagacagaaggagctggtcgttacg
gccaccacgacttgctgtggttataatccgatgacatcgt
gccctcgttgcatgtgcgatagtagctgcaacaagaaaaa
accaggccgcagaaacgactga
tgctccaggaccctctga
accacgacgt
Sequence translation MFTVFLLVVLATTLVSIPSDRASDFRNAAVHERQKELVVT
ATTTCCGYNPMTSCPRCMCDSSCNKKKPGRRND-

References

Internal links
Proteins Encoded Ac4.1 precursor

External links
Ncbi
GenBank FJ868059

Tools