Conus aurisiacus isolate A1.4 superfamily conotoxin gene, partialcds. (N01681) Nucleic Acid Card

General Information
Name Conus aurisiacus isolate A1.4 superfamily conotoxin gene, partialcds.
Organism Conus aurisiacus
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atccgtgtggttctgggtccagcatctgatggcagggatg
acgaagccaaagacaaaaggtctgacatgtacgaatcgga
ccggaatggacgctgttgccatccttcctgtggcagaaag
tataattgtggacgctga
tgctccaggaccctctgaacca
cgacctcgag
Sequence translation IRVVLGPASDGRDDEAKDKRSDMYESDRNGRCCHPSCGRK
YNCGR-

References

Internal links
Proteins Encoded A1.4 precursor

External links
Ncbi
GenBank FJ868061

Tools