Conus aurisiacus isolate A4.3 superfamily conotoxin gene, partial cds. (N01684) Nucleic Acid Card

General Information
Name Conus aurisiacus isolate A4.3 superfamily conotoxin gene, partial cds.
Organism Conus aurisiacus
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
aattcgcccttgaggatccgtgtggttctgggtccagaac
ctgatggcaggaatgccgcagtcaacgagagacagaaatg
gctggtccattcgaaaatcacgtattgctgtggttataat
aagatggacatgtgccctccttgcatgtgcacttattcct
gtccccccctaaaaaaaaaaagaccaggccgcagaaacga
ctga
tgctccaggaccctctgaaccacgacctcgagcgaa
gggcgaattc
Sequence translation NSPLRIRVVLGPEPDGRNAAVNERQKWLVHSKITYCCGYN
KMDMCPPCMCTYSCPPLKKKRPGRRND-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded A4.3 precursor

External links
Ncbi
GenBank FJ868064

Tools