Conus catus isolate C4.1a superfamily conotoxin gene, complete cds. (N01686) Nucleic Acid Card

General Information
Name Conus catus isolate C4.1a superfamily conotoxin gene, complete cds.
Organism Conus catus
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
attcaactgaccagctgcggaccagacggacgtgaaacag
catagccggcaagtggggatagtacaagacacgcagaaca
aggaagcagagagtctgagaaaatagccatgggcatgcgg
atg
atgttcaccgtgtttctgttggttggcttggcaacca
ctctcgtttccattccttcagatggtgcatctgatggcaa
gaatgccgcagtccacgagagacagaaggagctggtccct
tcgacaatcacgacttgctgtggtaatgaaccgggnacaa
tgtgccctaaatgcatgtgcgataatacctgtccccccaa
aaagaagaaaagaccaggccgcagaaacgactga
tgctcc
aggaccctctgaaccacgacatgccgccctctgcctgacc
tgcttcactttccgtctctttgtgccactagaactgtaca
actcgatccactagactcccacgttacctccgtattctga
aactacttggatttgatacttgctgttattacatcgtcca
aaatttaaacaagaacatgggtgtcttttgaaacaaaacc
aggcaatgataagggaaaaagtctccaatctatccgaaaa
ctgtcacccgtcattctcttaaccagttttagaactgatt
accactagagcttttgtaccacatcaaatccggtttatgt
gtaatgtctctttgcaaacttcgctgaaattcttgagaaa
aaagctcaaaatgtgggaagtgcttttggttatctgacaa
ctcgtcatcatgttctttttcagtgagtctaactgcaact
ttt
Sequence translation MFTVFLLVGLATTLVSIPSDGASDGKNAAVHERQKELVPS
TITTCCGNEP?TMCPKCMCDNTCPPKKKKRPGRRND-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded C4.1 precursor

External links
Ncbi
GenBank FJ868066

Tools