Conus arenatus clone ArMSGL-021 conotoxin scaffold VI/VII precursor, mRNA, complete cds (N00169) Nucleic Acid Card

General Information
Name Conus arenatus clone ArMSGL-021 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Organism Conus arenatus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
ctgtgataccagcccaaacctttcaactcactacgtggca
gttgcagttttcaacgtgtggacaggattgaagaaaattc
agg
atgtcaagattgggaatcatggtgctaactcttctac
ttcttgtgttcatagtaaccagtcatcaggatgcaggaga
gaagcaggcgacgcataggggcgcaatcaacttcagatgg
agaagatcactcattcggagaacagcaactgaggagtgcg
aagagtactgtgaggatgaggaaaagacctgctgcggctt
agaagatggagaacccgtatgtgccacgacatgcctcgga

tagtttctgtacactgtctcgttcattatcttatcagtac
aagtgtaaacgagatctatcagaaagtcaaaggttgtgcg
taatttgataagcactgtttactgggacgaacggatttga
gatgcaaagagaataaaacagcaataagaggaaaaaaaaa
aaaa
Sequence translation MSRLGIMVLTLLLLVFIVTSHQDAGEKQATHRGAINFRWR
RSLIRRTATEECEEYCEDEEKTCCGLEDGEPVCATTCLG

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Ar6.24 precursor

External links
Ncbi
GenBank AF215069

Tools