Conus consors isolate Cn1.4 superfamily conotoxin gene, partial cds. (N01697) Nucleic Acid Card

General Information
Name Conus consors isolate Cn1.4 superfamily conotoxin gene, partial cds.
Organism Conus consors
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
gcatctgatggcagggatgacgaagccaaagacgaaaggt
ctgacatgtacgaattgaaacggaatggacgctgttgcca
tcctgcctgtggcaaatactttaaatgtggacgctga
tgc
tccaggaccctctgaaccacgacgtgccggcctctgcctg
ac
Sequence translation ASDGRDDEAKDERSDMYELKRNGRCCHPACGKYFKCGR-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded CnIG precursor

External links
Ncbi
GenBank FJ868077

Tools