Conus consors isolate Cn4.1 superfamily conotoxin gene, complete cds. (N01700) Nucleic Acid Card

General Information
Name Conus consors isolate Cn4.1 superfamily conotoxin gene, complete cds.
Organism Conus consors
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccatcccttcagatcgtgcatctgatggcaggaa
tgccgcagtccatgagagagcgccttggctggtcccttcg
caaatcacgacttgctgtggttataatccggggacaatgt
gcccttcttgcatgtgcactaattcctgctaa
aaaaaaat
ggctgatgctcctggaccctctgaaccacgacgt
Sequence translation MFTVFLLVVLATTVVSIPSDRASDGRNAAVHERAPWLVPS
QITTCCGYNPGTMCPSCMCTNSC-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded Cn4.1 precursor

External links
Ncbi
GenBank FJ868080

Tools