Conus gauguini isolate Ga1.1 superfamily conotoxin gene, partial cds. (N01704) Nucleic Acid Card

General Information
Name Conus gauguini isolate Ga1.1 superfamily conotoxin gene, partial cds.
Organism Conus gauguini
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
gcatctgatggcaggaatgccgcagccgacgacaaagcgt
ctgacctggtcgctctggccgtcaggggaggatgctgttc
ccaccctgtctgttacgttaattatccacaaatttgtcgt
ggaagacgctga
tgctccaggaccctctgaaccacgacct
cgag
Sequence translation ASDGRNAAADDKASDLVALAVRGGCCSHPVCYVNYPQICR
GRR-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded Ga1.1 precursor

External links
Ncbi
GenBank FJ868084

Tools