Conus monachus isolate Mn1.5 superfamily conotoxin gene, partial cds. (N01711) Nucleic Acid Card

General Information
Name Conus monachus isolate Mn1.5 superfamily conotoxin gene, partial cds.
Organism Conus monachus
Organism Diet piscivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
gcatctgatggcagggatgacgaagccatagacgaaaggt
ctgacatgtacgaattgaaacggaatggacgctgttgcca
tcctgcctgtggcaaatactttagttgtggacgctga
tgc
tccaggaccctctgaaccacgacgt
Sequence translation ASDGRDDEAIDERSDMYELKRNGRCCHPACGKYFSCGR-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded Mn1.5 precursor

External links
Ncbi
GenBank FJ868091

Tools