Conus monachus isolate Mn4.2 superfamily conotoxin gene, complete cds. (N01713) Nucleic Acid Card

General Information
Name Conus monachus isolate Mn4.2 superfamily conotoxin gene, complete cds.
Organism Conus monachus
Organism Diet piscivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttccgttggtcgtcttggcaaccactc
tcgtttccatcccttcagatcgtgcatctgatggcaggaa
tgccgtagtccacgagagacagccttggctggtcccttcg
aaaatcacgaattgctgtggttataatacgatggaaatgt
gccctacttgcatgtgcacttattcctgtcgccccaaaaa
gaaaaaaccaggccgcagaaacgactga
tgctccaggacc
ctctgaaccacgacgt
Sequence translation MFTVFPLVVLATTLVSIPSDRASDGRNAVVHERQPWLVPS
KITNCCGYNTMEMCPTCMCTYSCRPKKKKPGRRND-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded Mn4.2 precursor

External links
Ncbi
GenBank FJ868094

Tools