Conus stercusmuscarum isolate Sm4.2 superfamily conotoxin gene, complete cds. (N01715) Nucleic Acid Card

General Information
Name Conus stercusmuscarum isolate Sm4.2 superfamily conotoxin gene, complete cds.
Organism Conus stercusmuscarum
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccatcccttcagatcgtgcatctgatggcaggaa
tgccgcagtcaacgagagagcgccttggctggtcccttcg
acaatcacgacttgctgtggatatgatccggggacaatgt
gccctccttgcatgtgcaataatacctgtaaaccaacaaa
aaaaagaccaggccgcagaaacgactga
tgctcccaggac
cctctgaaccacgacg
Sequence translation MFTVFLLVVLATTVVSIPSDRASDGRNAAVNERAPWLVPS
TITTCCGYDPGTMCPPCMCNNTCKPTKKRPGRRND-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded Sm4.2 precursor

External links
Ncbi
GenBank FJ868096

Tools