Conus striatus isolate S1.10b superfamily conotoxin gene, complete cds. (N01719) Nucleic Acid Card

General Information
Name Conus striatus isolate S1.10b superfamily conotoxin gene, complete cds.
Organism Conus striatus (Striated cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
attcacctgaccagctgcagaccagacggacgtgaaacag
catagccggcaagtggggatagtacaagacacgcagaaca
aagaagcagagagtctgagaaaataaccatgggcatgcgg
atg
atgttcaccgtgtttctgttggttgtcttgacaacca
ctgtcgtttccttcccttcagatagtgcatctgatggcag
ggatgacgaagccaaagacgaaaggtctgacatgcacgaa
tcggaccggaatggacgcggatgctgttgcaatcctgcct
gtggcccaaactatggttgtggcacctcatgctccaggac
catctga
accacgacatgccgccctctgcctgacctgctt
cactttccgtctctttgtgccactagaactctacaactcg
acccactagactcccacgttacctccgtattctgaaacta
cttggatttgattgtctttaatatctgctcatacttgctg
ttattacatcgtacaaaatttaaacaagaacatgaggggt
gtctgctcaaacaaaatcaggcaatgaccaggaaaaaagt
ctctgatctatccgaaaactgtcacctgtcactctcttaa
ccagttttagaactgattaccactggagcttttgtaccac
atcaaccaggtctatgtgtaatgtttcgttttgcaaactt
tgctgtaattcttgacaaaaaagctcaaaatgtgggaagc
gcttttgattgtctgacaacttgtgatcatgtctcttttc
agtgagtctaagtgcaacctctgtgtgttttccttcacct
gttaagcaacgaaaagaggttgtccataatcagaaaagca
aaagacaaagaactgcttgagaatttcacgttatatatag
ggaagcgataaaaaaaaa
Sequence translation MFTVFLLVVLTTTVVSFPSDSASDGRDDEAKDERSDMHES
DRNGRGCCCNPACGPNYGCGTSCSRTI-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded SII precursor

External links
Ncbi
GenBank FJ868100

Tools