Conus californicus isolate W-59 conotoxin Cal 6.2 precursor, mRNA, complete cds. (N01732) Nucleic Acid Card

General Information
Name Conus californicus isolate W-59 conotoxin Cal 6.2 precursor, mRNA, complete cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaaactgacgtgcgtgttgatcattgctgtgctgatct
tgactgcctgccagttcatcgcagctgacaatacggaata
tcgcaagtggcgtcgtagtggaacgtcgactggcatgagg
ctgggcagtagggattgtggcccatggtgttggggtcaaa
acaaatgctgccccgatgagagctgcagaagtctccacga
atcttgcacatga
Sequence translation MKLTCVLIIAVLILTACQFIAADNTEYRKWRRSGTSTGMR
LGSRDCGPWCWGQNKCCPDESCRSLHESCT-

References

Internal links
Proteins Encoded Cal6.11 precursor

External links
Ncbi
GenBank GU306156

Tools