Conus californicus isolate Q-164 conotoxin Cal 6.3b precursor, mRNA, partial cds. (N01734) Nucleic Acid Card

General Information
Name Conus californicus isolate Q-164 conotoxin Cal 6.3b precursor, mRNA, partial cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
aaaaagaaaaggggttgggacaccccggctccatgtcact
attgccaatggaaaggaccgcagtgctgtgtctattattg
tagcagctgcaactatgaggaagccagggaagagggacat
tatgtttccagtcatctgctggagaggcaaggccgctga
Sequence translation KKKRGWDTPAPCHYCQWKGPQCCVYYCSSCNYEEAREEGH
YVSSHLLERQGR-

References

Internal links
Proteins Encoded Cal6.3b precursor

External links
Ncbi
GenBank GU306158

Tools