Conus californicus isolate Q-39 conotoxin Cal 6.1f precursor, mRNA, partial cds. (N01740) Nucleic Acid Card

General Information
Name Conus californicus isolate Q-39 conotoxin Cal 6.1f precursor, mRNA, partial cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
ggactcatcaggccaagcaagaggtgcattggcggcggtg
atccctgtgaatttcacagaccgtacacgtgctgcagtgg
atattgcatcgtcttcgtgtgcgcatga
Sequence translation GLIRPSKRCIGGGDPCEFHRPYTCCSGYCIVFVCA-

References

Internal links
Proteins Encoded Cal6.1f precursor

External links
Ncbi
GenBank GU306165

Tools