Conus californicus isolate Q-136 conotoxin Cal 14.1b precursor, mRNA, complete cds. (N01744) Nucleic Acid Card

General Information
Name Conus californicus isolate Q-136 conotoxin Cal 14.1b precursor, mRNA, complete cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaagctgtgtgtggtcattgtgctgctcatgctggcaa
tgcctttcaacgggggagaagcctctcggttctttaatca
gcacgctagaagtcaacgatctgggatgaaaacgcgaggg
atttggtgcgaccctccatgccctgagggcgagacgtgca
gaggcggagagtgtagtgatgagttcaacggtgatatggg
acgctga
Sequence translation MKLCVVIVLLMLAMPFNGGEASRFFNQHARSQRSGMKTRG
IWCDPPCPEGETCRGGECSDEFNGDMGR-

References

Internal links
Proteins Encoded Cal14.1b precursor

External links
Ncbi
GenBank GU289669

Tools