Cal14.13c precursor (N01745) Nucleic Acid Card

General Information
Name Cal14.13c precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaagctgtgtgtggtcnttgtgctgctcatgctggcaa
tgcctttcaacgggggagaagcctctcggttctttaatca
gcacgctagaagtcaacgatctgggatgaaaacgcgaggg
atttggtgcgaccctccatgccctgagggcgagacgtgca
gaggcggagagtgtagtgatgagttcaacggtgatttggg
aggctga
Sequence translation MKLCVV?VLLMLAMPFNGGEASRFFNQHARSQRSGMKTRG
IWCDPPCPEGETCRGGECSDEFNGDLGG-

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Proteins Encoded Cal14.13c precursor

External links
Ncbi
GenBank GU289670

Tools