Cal 5.1 L2 precursor (N01748) Nucleic Acid Card

General Information
Name Cal 5.1 L2 precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgagattttacatcggtctgatggctgctctcatgctga
cttcagtccttaggactgactcggcgtcagtcggtcaaac
gggaacaaaaagtgaattggctgtgatcgaaagggtcatc
agacagcgagatgctgcagacgttaagccagtagcacgcc
agaatgaaggtcctggccgggatccagcaccttgctgcca
acatccaatcgaaacatgctgtcgtcgctga
Sequence translation MRFYIGLMAALMLTSVLRTDSASVGQTGTKSELAVIERVI
RQRDAADVKPVARQNEGPGRDPAPCCQHPIETCCRR-

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Proteins Encoded Cal5.1 L2 precursor

External links
Ncbi
GenBank GU290199

Tools