Conus californicus isolate Cl-37 conotoxin Cal 5.2 precursor, mRNA, complete cds. (N01751) Nucleic Acid Card

General Information
Name Conus californicus isolate Cl-37 conotoxin Cal 5.2 precursor, mRNA, complete cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgatgtactgtctcccagtcgtctgcatccttctgttgc
tgattccatcttcagctacttttgttgtggaatcgagact
tgaaaaggaccaggctcagtcgtttactggagatgcctgg
aagcgggtctctccgatccatgagatgatacaacgctcac
aatgctgtgctgtgaaaaaaaattgctgccacgtcggtta
a
Sequence translation MMYCLPVVCILLLLIPSSATFVVESRLEKDQAQSFTGDAW
KRVSPIHEMIQRSQCCAVKKNCCHVG-

References

Internal links
Proteins Encoded Cal5.2 precursor

External links
Ncbi
GenBank GU290202

Tools