Conus californicus isolate Q-64 conotoxin Cal 1b precursor, mRNA, complete cds. (N01753) Nucleic Acid Card

General Information
Name Conus californicus isolate Q-64 conotoxin Cal 1b precursor, mRNA, complete cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgcgctgtcttccagtcttcatcatcctcctgctgctgg
catcgactgcagctgttgatgtcgcgggctccaagctcaa
aagacgtttggaacggaaaccatatcaaggatctcaagct
tacgtgaagaaaaccgcgtttggattacggttatgctgca
aaagacatcatggttgccacccgtgcggacggacatag
Sequence translation MRCLPVFIILLLLASTAAVDVAGSKLKRRLERKPYQGSQA
YVKKTAFGLRLCCKRHHGCHPCGRT-

References

Internal links
Proteins Encoded Cal1b precursor

External links
Ncbi
GenBank GU290204

Tools