Cal16.1 precursor (N01754) Nucleic Acid Card

General Information
Name Cal16.1 precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgcgctgtctgtcaatcttcgttcttctcgtgctgctcg
tttcatttgccgttgccgaattagatgtggagggggaaat
cgtcaagcagcttttaactcgaggaactctcaaagatgcc
gatttctggaagagactggagatgcagggttgcgtctgca
acgccaacgccaagttctgctgcggcgagggccggtaa
Sequence translation MRCLSIFVLLVLLVSFAVAELDVEGEIVKQLLTRGTLKDA
DFWKRLEMQGCVCNANAKFCCGEGR-

References

Internal links
Proteins Encoded Cal16.1 precursor

External links
Ncbi
GenBank GU299513

Tools