Conus californicus isolate T-21 conotoxin Cal 9.2f precursor, mRNA, partial cds. (N01761) Nucleic Acid Card

General Information
Name Conus californicus isolate T-21 conotoxin Cal 9.2f precursor, mRNA, partial cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
aaaaaaggagttactctgcgcgaagacgataggaccttcc
cctgcagttctgggctatgtgcatgcctgcccttggacag
ttattcttacatatgcctgtcgcccagctctagtaccgcg
aactgtgaaaatgacgaatgtataagcgaggacgattggt
aa
Sequence translation KKGVTLREDDRTFPCSSGLCACLPLDSYSYICLSPSSSTA
NCENDECISEDDW-

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Proteins Encoded Cal9.2f precursor

External links
Ncbi
GenBank GU299520

Tools