Conus betulinus conotoxin 11.1 gene, partial cds. (N01762) Nucleic Acid Card

General Information
Name Conus betulinus conotoxin 11.1 gene, partial cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgaagctgtgtgtggcgtttcttcttgttctggtgattc
tgccatcggtgattggggggaagcctagcgagcgtacact
gagtggtgctactcggagaggcgatcggagaatgtgctta
tccctaggacaaagatgcgaacgtcattccaactgctgtg
gctatctgtgttgtttctacgacaagtgtgttgtgactgc
catagggtgtggccactac
Sequence translation MKLCVAFLLVLVILPSVIGGKPSERTLSGATRRGDRRMCL
SLGQRCERHSNCCGYLCCFYDKCVVTAIGCGHY

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded Bt11.1 precursor

External links
Ncbi
GenBank FJ959108

Tools