GVIIIA precursor (N01764) Nucleic Acid Card

General Information
Name GVIIIA precursor
Organism Conus geographus (Geography cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
atgatgtcgaaaatgggagctatgtttgtccttttgcttc
ttttcaccctggcatccagcctgcaggaaggagatgtcca
ggcacggaaaacacgcctgaagagcgacttctaccgtgct
ctggcaagggatgaccgagggtgcactcgcacttgtggtg
gacccaagtgtacaggtacttgcacatgcacgaactcgtc
caaatgtggctgcaggtataacgtccatcctagtggatgg
ggatgcggatgtgcttgttccgga
Sequence translation MMSKMGAMFVLLLLFTLASSLQEGDVQARKTRLKSDFYRA
LARDDRGCTRTCGGPKCTGTCTCTNSSKCGCRYNVHPSGW
GCGCACSG

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded GVIIIA precursor

External links
Ncbi
GenBank FJ959110

Tools