Conus marmoreus conotoxin 10a gene, partial cds. (N01766) Nucleic Acid Card

General Information
Name Conus marmoreus conotoxin 10a gene, partial cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgtctcccagtcttgatcattcttctgctgctga
ctgcatctgcacctggcgttgttgtcctaccgaagaccga
agatgatgtgcccatgtcatctgtctacggtaatggaaag
agtatcctacgaggaattctgaggaacggtgtttgctgtg
gctataagttgtgccatccatgt
ag
Sequence translation MRCLPVLIILLLLTASAPGVVVLPKTEDDVPMSSVYGNGK
SILRGILRNGVCCGYKLCHPC

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded MrIA precursor

External links
Ncbi
GenBank FJ959112, GQ981407

Tools