RVIIIA precursor (N01767) Nucleic Acid Card

General Information
Name RVIIIA precursor
Organism Conus radiatus
Organism Diet piscivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgatgtcgaaaatgggagctatgtttgtccttttgcttc
ttttcaccctggcatccagccagcaggaaggagatgtcca
ggcaaggaaaacacacccgaagagagagttccaacgtatt
ctgctaaggtctggcagaaagtgcaatttcgacaaatgta
aaggtaccggagtctacaattgtggggaatcctgctcatg
cgaaggtttgcacagttgtcgctgcacttataacatcggt
tctatgaagtctggatgcgcgtgtatttgtacatactat
Sequence translation MMSKMGAMFVLLLLFTLASSQQEGDVQARKTHPKREFQRI
LLRSGRKCNFDKCKGTGVYNCGESCSCEGLHSCRCTYNIG
SMKSGCACICTYY

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded RVIIIA precursor

External links
Ncbi
GenBank FJ959114

Tools