Conus californicus conotoxin ClS1 gene, partial cds. (N01768) Nucleic Acid Card

General Information
Name Conus californicus conotoxin ClS1 gene, partial cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgatgtcaactaaaggaatcacgctgttcctctgcctgc
ttctgttggccctggcaaccagtgttaacggaggtcaagg
cacccgaaggtccaggatgaccagagcactgcacgggggc
agaccaagtgcccgatacgatgccccgtactgttcccagg
aagaggttcgggagtgtcacgatgactgtagcggtaatcc
tgtcagggacgcctgtcagtgtgcctatgacccagcagga
agtccagcgtgtgattgttactgcgtggaaccatggcgac
gt
Sequence translation MMSTKGITLFLCLLLLALATSVNGGQGTRRSRMTRALHGG
RPSARYDAPYCSQEEVRECHDDCSGNPVRDACQCAYDPAG
SPACDCYCVEPWRR

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded Cal22a precursor

External links
Ncbi
GenBank FJ959115

Tools