Cal1.3 precursor (N01772) Nucleic Acid Card

General Information
Name Cal1.3 precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgcgctgtcttccagtcttcatcatcctcctgctgctgg
catcgactgcagctgttgatgtcgcgggctccaagctcaa
aagacgtttggaacggaaaccatatcaaggatctcaagct
tacgtgaagaaaaccgcgtttggattacggaaatgctgca
aaaaacatcatggttgccacccgtgcggacggaaa
Sequence translation MRCLPVFIILLLLASTAAVDVAGSKLKRRLERKPYQGSQA
YVKKTAFGLRKCCKKHHGCHPCGRK

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Proteins Encoded Cal1.3 precursor

External links
Ncbi
GenBank FJ959119, GU290203

Tools