Cal12.2d precursor (N01776) Nucleic Acid Card

General Information
Name Cal12.2d precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaaactgacgtgcgtgctggtcgttcttcttctggttc
tgccctttggtgacctcatcaccactagtaacaccgaaga
taataagagaggtgctactccatggcagaacagcttgaaa
gctcgtggcgtgtgcagcacgcccgaaggatcatgtgtcc
acaacggatgcatatgtcagaacgcaccttgctgtcacgc
gtccggttgtaactgggccaatgtttgcccaggtttctta
tgggacaaaaac
Sequence translation MKLTCVLVVLLLVLPFGDLITTSNTEDNKRGATPWQNSLK
ARGVCSTPEGSCVHNGCICQNAPCCHASGCNWANVCPGFL
WDKN

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded Cal12.2d precursor

External links
Ncbi
GenBank FJ959123

Tools