CalTx 12.1.4C precursor (N01777) Nucleic Acid Card

General Information
Name CalTx 12.1.4C precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaaactgacgtgcgtgctggtcgttcttctcctgcttc
tgccgtatggtgacctcatcaccaatagttacatcagagg
ggcagccagaaaggtcacaccatggcgaaggaacttgaaa
actcgggacgtctgcgattcgctggtagacggacgctgta
tccacaatggctgtttttgtgaggaatctaaacccaatgg
taattgctgcgacactggcggctgtgtatggtggtggtgt
cccgggaccaaatgggac
Sequence translation MKLTCVLVVLLLLLPYGDLITNSYIRGAARKVTPWRRNLK
TRDVCDSLVDGRCIHNGCFCEESKPNGNCCDTGGCVWWWC
PGTKWD

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded CalTx 12.1.4C precursor

External links
Ncbi
GenBank FJ959124

Tools