Conus californicus conotoxin Cl6.1 gene, partial cds. (N01802) Nucleic Acid Card

General Information
Name Conus californicus conotoxin Cl6.1 gene, partial cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaaactgacgaccgtgttagttgttgctctgctggtct
tggcagcctgtcagttcactgtaactgataactcgggaga
tgacccggagaatccttctttgaggtcggctggcgagaac
cagaatcctgattcgaccaaaacaatcactgcatgggcga
caagggacatgacaaacatgagaaggggactcaacaggcc
aagcaagaggtgcctggccggcagtgcacgctgtgaattt
cacaaaccgtcctcgtgctgcagtggacattgcatcttct
ggtggtgcgca
Sequence translation MKLTTVLVVALLVLAACQFTVTDNSGDDPENPSLRSAGEN
QNPDSTKTITAWATRDMTNMRRGLNRPSKRCLAGSARCEF
HKPSSCCSGHCIFWWCA

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded Cal6.1a precursor

External links
Ncbi
GenBank FJ959150

Tools