Cal6.6a precursor (N01807) Nucleic Acid Card

General Information
Name Cal6.6a precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaaactgacgtgtgtgttgatcgctgctgtgctgctcc
tggcagtctgccagctcgactcggctgatgccactggata
tatgcggaagaacccatccctgcgttcgcccaaaaggacc
agaggctgcaaatccaaaggctctttctgttggaatggca
tcgaatgctgcggtgggaactgttttttcgcttgcatcta
c
Sequence translation MKLTCVLIAAVLLLAVCQLDSADATGYMRKNPSLRSPKRT
RGCKSKGSFCWNGIECCGGNCFFACIY

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded Cal6.6a precursor

External links
Ncbi
GenBank FJ959155

Tools