Conus californicus conotoxin Cl6.6a gene, partial cds. (N01807) Nucleic Acid Card

General Information
Name Conus californicus conotoxin Cl6.6a gene, partial cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaaactgacgtgtgtgttgatcgctgctgtgctgctcc
tggcagtctgccagctcgactcggctgatgccactggata
tatgcggaagaacccatccctgcgttcgcccaaaaggacc
agaggctgcaaatccaaaggctctttctgttggaatggca
tcgaatgctgcggtgggaactgttttttcgcttgcatcta
c
Sequence translation MKLTCVLIAAVLLLAVCQLDSADATGYMRKNPSLRSPKRT
RGCKSKGSFCWNGIECCGGNCFFACIY

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Proteins Encoded Cl6.6a precursor

External links
Ncbi
GenBank FJ959155

Tools