Conus purpurascens psi conotoxin M-superfamily protein mRNA, partial cds. (N01844) Nucleic Acid Card

General Information
Name Conus purpurascens psi conotoxin M-superfamily protein mRNA, partial cds.
Organism Conus purpurascens
Organism Diet piscivorous
Organism Clade III
Organism Region Eastern Pacific
Notes

Sequence
atgatgtctaaactgggagccttgttgaccatctgtctgc
ttctgtttcccattactgctcttctgatggatggagatca
acctgcagaccgacctgcagaacgtatggattacgacatt
tcatctgaggtgcatcgtttgcttgaaaggagacacccgc
cctgttgcatgtacggcagatgccgtcgatatcccggatg
ctctagtgcctcttgttgccagggagga
Sequence translation MMSKLGALLTICLLLFPITALLMDGDQPADRPAERMDYDI
SSEVHRLLERRHPPCCMYGRCRRYPGCSSASCCQGG

References

Internal links
Proteins Encoded P3.9 precursor

External links
Ncbi
GenBank GQ981404

Tools